Lineage for d2qy9a2 (2qy9 A:285-495)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2869013Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 2869141Protein GTPase domain of the signal recognition particle receptor FtsY [52666] (3 species)
  7. 2869142Species Escherichia coli [TaxId:562] [52667] (2 PDB entries)
  8. 2869143Domain d2qy9a2: 2qy9 A:285-495 [151470]
    Other proteins in same PDB: d2qy9a1
    automated match to d2qy9a2

Details for d2qy9a2

PDB Entry: 2qy9 (more details), 1.9 Å

PDB Description: Structure of the NG+1 construct of the E. coli SRP receptor FtsY
PDB Compounds: (A:) cell division protein ftsy

SCOPe Domain Sequences for d2qy9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]}
plnvegkapfvilmvgvngvgktttigklarqfeqqgksvmlaagdtfraaaveqlqvwg
qrnnipviaqhtgadsasvifdaiqaakarnidvliadtagrlqnkshlmeelkkivrvm
kkldveaphevmltidastgqnavsqaklfheavgltgitltkldgtakggvifsvadqf
gipiryigvgeriedlrpfkaddfiealfar

SCOPe Domain Coordinates for d2qy9a2:

Click to download the PDB-style file with coordinates for d2qy9a2.
(The format of our PDB-style files is described here.)

Timeline for d2qy9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qy9a1