SCOPe 2.04: Domain d2qy0b_: 2qy0 B:

Lineage for d2qy0b_ (2qy0 B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.0: automated matches [191364] (1 protein)
   not a true family

6. Protein automated matches [190438] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187421] (42 PDB entries)

8. Domain d2qy0b_: 2qy0 B: [151467]
   Other proteins in same PDB: d2qy0a1, d2qy0a2, d2qy0c1, d2qy0c2
   automated match to d2qxia_
   complexed with gol

Details for d2qy0b_

PDB Entry: 2qy0, 2.6 Å

PDB Description: Active dimeric structure of the catalytic domain of C1r reveals enzyme-product like contacts

PDB Compounds: (B:) Complement C1r subcomponent

SCOPe Domain Sequences for d2qy0b_:

Sequence, based on SEQRES records:

>d2qy0b_ b.47.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iiggqkakmgnfpwqvftnihgrgggallgdrwiltaahtlypkeheaqsnasldvflgh
tnveelmklgnhpirrvsvhpdyrqdesynfegdiallelensvtlgpnllpiclpdndt
fydlglmgyvsgfgvmeekiahdlrfvrlpvanpqacenwlrgknrmdvfsqnmfcaghp
slkqdacqgdsggvfavrdpntdrwvatgivswgigcsrgygfytkvlnyvdwikkemee

Sequence, based on observed residues (ATOM records):

>d2qy0b_ b.47.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iiggqkakmgnfpwqvftnihgrgggallgdrwiltaahtlypkeheasldvflghtnve
elmklgnhpirrvsvhpdyrqdesynfegdiallelensvtlgpnllpiclpdndtfydl
glmgyvsgfgvmeekiahdlrfvrlpvanpqacenwlrgknrmdvfsqnmfcaghpslkq
dacqgdsggvfavrdpntdrwvatgivswgigcsrgygfytkvlnyvdwikkemee

Timeline for d2qy0b_:

• d2qy0b_ first appeared in SCOP 1.75, called d2qy0b1
  
• d2qy0b_ appears in SCOPe 2.03
  
• d2qy0b_ appears in SCOPe 2.05
  
• d2qy0b_ appears in the current release, SCOPe 2.08