Class b: All beta proteins [48724] (176 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.0: automated matches [191364] (1 protein) not a true family |
Protein automated matches [190438] (19 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187421] (42 PDB entries) |
Domain d2qy0b_: 2qy0 B: [151467] Other proteins in same PDB: d2qy0a1, d2qy0a2, d2qy0c1, d2qy0c2 automated match to d2qxia_ complexed with gol |
PDB Entry: 2qy0 (more details), 2.6 Å
SCOPe Domain Sequences for d2qy0b_:
Sequence, based on SEQRES records: (download)
>d2qy0b_ b.47.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} iiggqkakmgnfpwqvftnihgrgggallgdrwiltaahtlypkeheaqsnasldvflgh tnveelmklgnhpirrvsvhpdyrqdesynfegdiallelensvtlgpnllpiclpdndt fydlglmgyvsgfgvmeekiahdlrfvrlpvanpqacenwlrgknrmdvfsqnmfcaghp slkqdacqgdsggvfavrdpntdrwvatgivswgigcsrgygfytkvlnyvdwikkemee
>d2qy0b_ b.47.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} iiggqkakmgnfpwqvftnihgrgggallgdrwiltaahtlypkeheasldvflghtnve elmklgnhpirrvsvhpdyrqdesynfegdiallelensvtlgpnllpiclpdndtfydl glmgyvsgfgvmeekiahdlrfvrlpvanpqacenwlrgknrmdvfsqnmfcaghpslkq dacqgdsggvfavrdpntdrwvatgivswgigcsrgygfytkvlnyvdwikkemee
Timeline for d2qy0b_: