Lineage for d2qwra1 (2qwr A:4-188)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 835945Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 835946Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) (S)
    duplication contains two domains of this fold
  5. 835947Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)
  6. 836126Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species)
  7. 836127Species Cow (Bos taurus) [TaxId:9913] [53070] (35 PDB entries)
  8. 836192Domain d2qwra1: 2qwr A:4-188 [151436]
    automatically matched to d1atra1
    complexed with acy, anp, gol; mutant

Details for d2qwra1

PDB Entry: 2qwr (more details), 2.21 Å

PDB Description: crystal structure of disulfide-bond-crosslinked complex of bovine hsc70 (1-394aa)r171c and bovine auxilin (810-910aa)d876c in the amppnp intact form
PDB Compounds: (A:) Heat shock cognate 71 kDa protein

SCOP Domain Sequences for d2qwra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qwra1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]}
gpavgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvamnp
tntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevssmv
ltkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlciineptaaaiay
gldkk

SCOP Domain Coordinates for d2qwra1:

Click to download the PDB-style file with coordinates for d2qwra1.
(The format of our PDB-style files is described here.)

Timeline for d2qwra1: