Lineage for d2qwmb1 (2qwm B:4-188)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 995076Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 995077Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) (S)
    duplication contains two domains of this fold
  5. 995078Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)
  6. 995257Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species)
  7. 995258Species Cow (Bos taurus) [TaxId:9913] [53070] (35 PDB entries)
  8. 995283Domain d2qwmb1: 2qwm B:4-188 [151425]
    automatically matched to d1atra1
    complexed with adp, gol, mg, na, vo4

Details for d2qwmb1

PDB Entry: 2qwm (more details), 1.86 Å

PDB Description: crystal structure of bovine hsc70 (1-394aa)in the adp*vi state
PDB Compounds: (B:) Heat shock cognate 71 kDa protein

SCOPe Domain Sequences for d2qwmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qwmb1 c.55.1.1 (B:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]}
gpavgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvamnp
tntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevssmv
ltkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriineptaaaiay
gldkk

SCOPe Domain Coordinates for d2qwmb1:

Click to download the PDB-style file with coordinates for d2qwmb1.
(The format of our PDB-style files is described here.)

Timeline for d2qwmb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qwmb2