| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.1: Actin/HSP70 [53068] (7 proteins) |
| Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species) |
| Species Cow (Bos taurus) [TaxId:9913] [53070] (35 PDB entries) |
| Domain d2qwmb1: 2qwm B:4-188 [151425] automatically matched to d1atra1 complexed with adp, gol, mg, na, vo4 |
PDB Entry: 2qwm (more details), 1.86 Å
SCOPe Domain Sequences for d2qwmb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qwmb1 c.55.1.1 (B:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]}
gpavgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvamnp
tntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevssmv
ltkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriineptaaaiay
gldkk
Timeline for d2qwmb1: