SCOP 1.63: Domain d108m__: 108m -

Lineage for d108m__ (108m -)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (18 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (137 PDB entries)

8. Domain d108m__: 108m - [15142]
   complexed with hem, nbn, so4; mutant

Details for d108m__

PDB Entry: 108m, 2.67 Å

PDB Description: sperm whale myoglobin v68f n-butyl isocyanide at ph 7.0

SCOP Domain Sequences for d108m__:

Sequence; same for both SEQRES and ATOM records:

>d108m__ a.1.1.2 (-) Myoglobin {Sperm whale (Physeter catodon)}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtfltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg

Timeline for d108m__:

• d108m__ first appeared (with stable ids) in SCOP 1.55
  
• d108m__ appears in SCOP 1.61
  
• d108m__ appears in SCOP 1.65
  
• d108m__ appears in the current release, SCOPe 2.08, called d108ma_