| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
| Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species) |
| Species Cow (Bos taurus) [TaxId:9913] [53070] (35 PDB entries) |
| Domain d2qw9b1: 2qw9 B:3-188 [151417] automated match to d1atra1 complexed with gol |
PDB Entry: 2qw9 (more details), 1.85 Å
SCOPe Domain Sequences for d2qw9b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qw9b1 c.55.1.1 (B:3-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]}
kgpavgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvamn
ptntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevssm
vltkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriineptaaaia
ygldkk
Timeline for d2qw9b1: