SCOP 1.75: Domain d2qw9b1: 2qw9 B:3-188

Lineage for d2qw9b1 (2qw9 B:3-188)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)

6. Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [53070] (35 PDB entries)

8. Domain d2qw9b1: 2qw9 B:3-188 [151417]
   automatically matched to d1atra1
   complexed with gol

Details for d2qw9b1

PDB Entry: 2qw9, 1.85 Å

PDB Description: crystal structure of bovine hsc70 (1-394aa)in the apo state

PDB Compounds: (B:) Heat shock cognate 71 kDa protein

SCOP Domain Sequences for d2qw9b1:

Sequence; same for both SEQRES and ATOM records:

>d2qw9b1 c.55.1.1 (B:3-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]}
kgpavgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvamn
ptntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevssm
vltkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriineptaaaia
ygldkk

Timeline for d2qw9b1:

• d2qw9b1 is new in SCOP 1.75
  
• d2qw9b1 appears in SCOPe 2.01
  
• d2qw9b1 appears in the current release, SCOPe 2.08