Lineage for d2quka1 (2quk A:97-469)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1160658Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1160659Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1160660Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 1160754Protein Tryptophanyl-tRNA synthetase (TrpRS) [52378] (4 species)
    overall structure is similar to TyrRS
  7. 1160804Species Human (Homo sapiens) [TaxId:9606] [102256] (11 PDB entries)
    Uniprot P23381 94-471
  8. 1160822Domain d2quka1: 2quk A:97-469 [151375]
    automatically matched to d1ulhb_
    protein/RNA complex

Details for d2quka1

PDB Entry: 2quk (more details), 2.8 Å

PDB Description: Crystal structures of human tryptophanyl-tRNA synthetase in complex with ATP(putative)
PDB Compounds: (A:) Tryptophanyl-tRNA synthetase

SCOPe Domain Sequences for d2quka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2quka1 c.26.1.1 (A:97-469) Tryptophanyl-tRNA synthetase (TrpRS) {Human (Homo sapiens) [TaxId: 9606]}
gidydklivrfgsskidkelinrieratgqrphhflrrgiffshrdmnqvldayenkkpf
ylytgrgpsseamhvghlipfiftkwlqdvfnvplviqmtddekylwkdltldqaysyav
enakdiiacgfdinktfifsdldymgmssgfyknvvkiqkhvtfnqvkgifgftdsdcig
kisfpaiqaapsfsnsfpqifrdrtdiqclipcaidqdpyfrmtrdvaprigypkpallh
stffpalqgaqtkmsasdpnssifltdtakqiktkvnkhafsggrdtieehrqfggncdv
dvsfmyltffledddkleqirkdytsgamltgelkkalievlqpliaehqarrkevtdei
vkefmtprklsfd

SCOPe Domain Coordinates for d2quka1:

Click to download the PDB-style file with coordinates for d2quka1.
(The format of our PDB-style files is described here.)

Timeline for d2quka1: