Lineage for d2qu4a2 (2qu4 A:158-320)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1605036Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1605037Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 1605386Protein Plasmid segregation protein ParM [82438] (1 species)
  7. 1605387Species Escherichia coli [TaxId:562] [82439] (6 PDB entries)
  8. 1605405Domain d2qu4a2: 2qu4 A:158-320 [151366]
    automatically matched to d1mwka2

Details for d2qu4a2

PDB Entry: 2qu4 (more details), 16 Å

PDB Description: Model for Bacterial ParM Filament
PDB Compounds: (A:) Plasmid segregation protein parM

SCOPe Domain Sequences for d2qu4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qu4a2 c.55.1.1 (A:158-320) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]}
qeldeldslliidlggttldisqvmgklsgiskiygdsslgvslvtsavkdalslartkg
ssyladdiiihrkdnnylkqrindenkisivteamnealrkleqrvlntlnefsgythvm
vigggaelicdavkkhtqirderffktnnsqydlvngmylign

SCOPe Domain Coordinates for d2qu4a2:

Click to download the PDB-style file with coordinates for d2qu4a2.
(The format of our PDB-style files is described here.)

Timeline for d2qu4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qu4a1