SCOPe 2.04: Domain d2qs8b1: 2qs8 B:6-63,B:374-410

Lineage for d2qs8b1 (2qs8 B:6-63,B:374-410)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
   pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns

4. Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families)
   this domain is interrupted by the catalytic beta/alpha barrel domain

5. Family b.92.1.9: Zn-dependent arginine carboxypeptidase-like [159340] (3 proteins)

6. Protein Xaa-Pro dipeptidase [159345] (1 species)

7. Species Alteromonas macleodii [TaxId:28108] [159346] (1 PDB entry)

8. Domain d2qs8b1: 2qs8 B:6-63,B:374-410 [151313]
   Other proteins in same PDB: d2qs8a2, d2qs8b2
   automated match to d2qs8a1
   complexed with met, mg

Details for d2qs8b1

PDB Entry: 2qs8, 2.33 Å

PDB Description: crystal structure of a xaa-pro dipeptidase with bound methionine in the active site

PDB Compounds: (B:) Xaa-Pro Dipeptidase

SCOPe Domain Sequences for d2qs8b1:

Sequence; same for both SEQRES and ATOM records:

>d2qs8b1 b.92.1.9 (B:6-63,B:374-410) Xaa-Pro dipeptidase {Alteromonas macleodii [TaxId: 28108]}
dsktlihagklidgksdqvqsrisividgniisdikkgfissndfedyidlrdhtvlpXs
iesgkladliavkgnpiedisvlenvdvvikdglly

Timeline for d2qs8b1:

• d2qs8b1 first appeared in SCOP 1.75
  
• d2qs8b1 appears in SCOPe 2.03
  
• d2qs8b1 appears in SCOPe 2.05
  
• d2qs8b1 appears in the current release, SCOPe 2.08