Lineage for d2myaa_ (2mya A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2301307Protein Myoglobin [46469] (10 species)
  7. 2301477Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (316 PDB entries)
    Uniprot P02185
  8. 2301671Domain d2myaa_: 2mya A: [15131]
    complexed with enc, hem, so4

Details for d2myaa_

PDB Entry: 2mya (more details), 1.8 Å

PDB Description: high resolution x-ray structures of myoglobin-and hemoglobin-alkyl isocyanide complexes
PDB Compounds: (A:) myoglobin (ethyl isocyanide)

SCOPe Domain Sequences for d2myaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2myaa_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg

SCOPe Domain Coordinates for d2myaa_:

Click to download the PDB-style file with coordinates for d2myaa_.
(The format of our PDB-style files is described here.)

Timeline for d2myaa_: