Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.353: AMPKBI-like [160218] (1 superfamily) comprises 3 short helices and 3-stranded meander beta-sheet; makes extensive intermolecular interactions |
Superfamily d.353.1: AMPKBI-like [160219] (1 family) |
Family d.353.1.1: AMPKBI-like [160220] (3 proteins) Pfam PF04739; 5'-AMP-activated protein kinase, beta subunit, complex-interacting region |
Protein AMP-activated protein kinase beta subunit [160225] (1 species) |
Species Schizosaccharomyces pombe [TaxId:4896] [160226] (6 PDB entries) Uniprot P78789 205-297 Spcc1919.03c |
Domain d2qred1: 2qre D:207-297 [151293] Other proteins in same PDB: d2qrea1, d2qrec1 automatically matched to 2OOX B:205-297 complexed with amz |
PDB Entry: 2qre (more details), 3.01 Å
SCOP Domain Sequences for d2qred1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qred1 d.353.1.1 (D:207-297) AMP-activated protein kinase beta subunit {Schizosaccharomyces pombe [TaxId: 4896]} qysteipafltsntlqelklpkppslpphlekcilnsntaykedqsvlpnpnhvllnhla aantqlgvlalsattryhrkyvttamfknfd
Timeline for d2qred1: