SCOP 1.75: Domain d2qreb1: 2qre B:207-297

Lineage for d2qreb1 (2qre B:207-297)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.353: AMPKBI-like [160218] (1 superfamily)
   comprises 3 short helices and 3-stranded meander beta-sheet; makes extensive intermolecular interactions

4. Superfamily d.353.1: AMPKBI-like [160219] (1 family)

5. Family d.353.1.1: AMPKBI-like [160220] (3 proteins)
   Pfam PF04739; 5'-AMP-activated protein kinase, beta subunit, complex-interacting region

6. Protein AMP-activated protein kinase beta subunit [160225] (1 species)

7. Species Schizosaccharomyces pombe [TaxId:4896] [160226] (6 PDB entries)
   Uniprot P78789 205-297
   Spcc1919.03c

8. Domain d2qreb1: 2qre B:207-297 [151291]
   Other proteins in same PDB: d2qrea1, d2qrec1
   automatically matched to 2OOX B:205-297
   complexed with amz

Details for d2qreb1

PDB Entry: 2qre, 3.01 Å

PDB Description: Crystal structure of the adenylate sensor from AMP-activated protein kinase in complex with 5-aminoimidazole-4-carboxamide 1-beta-D-ribofuranotide (ZMP)

PDB Compounds: (B:) SPCC1919.03c protein

SCOP Domain Sequences for d2qreb1:

Sequence, based on SEQRES records:

>d2qreb1 d.353.1.1 (B:207-297) AMP-activated protein kinase beta subunit {Schizosaccharomyces pombe [TaxId: 4896]}
qysteipafltsntlqelklpkppslpphlekcilnsntaykedqsvlpnpnhvllnhla
aantqlgvlalsattryhrkyvttamfknfd

Sequence, based on observed residues (ATOM records):

>d2qreb1 d.353.1.1 (B:207-297) AMP-activated protein kinase beta subunit {Schizosaccharomyces pombe [TaxId: 4896]}
qysteipafltslqelklpkppslpphlekcilnsntdqsvlpnpnhvllnhlaaantql
gvlalsattryhrkyvttamfknfd

Timeline for d2qreb1:

• d2qreb1 is new in SCOP 1.75
  
• d2qreb1 appears in SCOPe 2.01
  
• d2qreb1 appears in the current release, SCOPe 2.08, called d2qreb_