Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.353: AMPKBI-like [160218] (1 superfamily) comprises 3 short helices and 3-stranded meander beta-sheet; makes extensive intermolecular interactions |
Superfamily d.353.1: AMPKBI-like [160219] (1 family) automatically mapped to Pfam PF04739 |
Family d.353.1.1: AMPKBI-like [160220] (4 proteins) Pfam PF04739; 5'-AMP-activated protein kinase, beta subunit, complex-interacting region |
Protein automated matches [190789] (2 species) not a true protein |
Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [188232] (4 PDB entries) |
Domain d2qrcd_: 2qrc D: [151285] Other proteins in same PDB: d2qrca_, d2qrcc_, d2qrce1, d2qrce2, d2qrcg1, d2qrcg2 automated match to d2ooxb1 complexed with adp, amp |
PDB Entry: 2qrc (more details), 2.7 Å
SCOPe Domain Sequences for d2qrcd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qrcd_ d.353.1.1 (D:) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} qysteipafltsntlqelklpkppslpphlekcilnsntaykedqsvlpnpnhvllnhla aantqlgvlalsattryhrkyvttamfknfd
Timeline for d2qrcd_: