Lineage for d2qrcd_ (2qrc D:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1232233Fold d.353: AMPKBI-like [160218] (1 superfamily)
    comprises 3 short helices and 3-stranded meander beta-sheet; makes extensive intermolecular interactions
  4. 1232234Superfamily d.353.1: AMPKBI-like [160219] (1 family) (S)
  5. 1232235Family d.353.1.1: AMPKBI-like [160220] (4 proteins)
    Pfam PF04739; 5'-AMP-activated protein kinase, beta subunit, complex-interacting region
  6. 1232251Protein automated matches [190789] (2 species)
    not a true protein
  7. 1232252Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [188232] (3 PDB entries)
  8. 1232258Domain d2qrcd_: 2qrc D: [151285]
    Other proteins in same PDB: d2qrca_, d2qrcc_
    automated match to d2ooxb1
    complexed with adp, amp

Details for d2qrcd_

PDB Entry: 2qrc (more details), 2.7 Å

PDB Description: Crystal structure of the adenylate sensor from AMP-activated protein kinase in complex with ADP and AMP
PDB Compounds: (D:) SPCC1919.03c protein

SCOPe Domain Sequences for d2qrcd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qrcd_ d.353.1.1 (D:) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
qysteipafltsntlqelklpkppslpphlekcilnsntaykedqsvlpnpnhvllnhla
aantqlgvlalsattryhrkyvttamfknfd

SCOPe Domain Coordinates for d2qrcd_:

Click to download the PDB-style file with coordinates for d2qrcd_.
(The format of our PDB-style files is described here.)

Timeline for d2qrcd_: