SCOPe 2.01: Domain d2qrcb_: 2qrc B:

Lineage for d2qrcb_ (2qrc B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.353: AMPKBI-like [160218] (1 superfamily)
   comprises 3 short helices and 3-stranded meander beta-sheet; makes extensive intermolecular interactions

4. Superfamily d.353.1: AMPKBI-like [160219] (1 family)

5. Family d.353.1.1: AMPKBI-like [160220] (4 proteins)
   Pfam PF04739; 5'-AMP-activated protein kinase, beta subunit, complex-interacting region

6. Protein automated matches [190789] (2 species)
   not a true protein

7. Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [188232] (3 PDB entries)

8. Domain d2qrcb_: 2qrc B: [151283]
   Other proteins in same PDB: d2qrca_, d2qrcc_
   automated match to d2ooxb1
   complexed with adp, amp

Details for d2qrcb_

PDB Entry: 2qrc, 2.7 Å

PDB Description: Crystal structure of the adenylate sensor from AMP-activated protein kinase in complex with ADP and AMP

PDB Compounds: (B:) SPCC1919.03c protein

SCOPe Domain Sequences for d2qrcb_:

Sequence; same for both SEQRES and ATOM records:

>d2qrcb_ d.353.1.1 (B:) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
qysteipafltsntlqelklpkppslpphlekcilnsntaykedqsvlpnpnhvllnhla
aantqlgvlalsattryhrkyvttamfknfd

Timeline for d2qrcb_:

• d2qrcb_ first appeared in SCOP 1.75, called d2qrcb1
  
• d2qrcb_ appears in SCOPe 2.02
  
• d2qrcb_ appears in the current release, SCOPe 2.08