![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.353: AMPKBI-like [160218] (1 superfamily) comprises 3 short helices and 3-stranded meander beta-sheet; makes extensive intermolecular interactions |
![]() | Superfamily d.353.1: AMPKBI-like [160219] (1 family) ![]() |
![]() | Family d.353.1.1: AMPKBI-like [160220] (3 proteins) Pfam PF04739; 5'-AMP-activated protein kinase, beta subunit, complex-interacting region |
![]() | Protein AMP-activated protein kinase beta subunit [160225] (1 species) |
![]() | Species Schizosaccharomyces pombe [TaxId:4896] [160226] (6 PDB entries) Uniprot P78789 205-297 Spcc1919.03c |
![]() | Domain d2qr1b1: 2qr1 B:207-297 [151275] Other proteins in same PDB: d2qr1a1, d2qr1c1 automatically matched to 2OOX B:205-297 complexed with adp |
PDB Entry: 2qr1 (more details), 2.7 Å
SCOP Domain Sequences for d2qr1b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qr1b1 d.353.1.1 (B:207-297) AMP-activated protein kinase beta subunit {Schizosaccharomyces pombe [TaxId: 4896]} qysteipafltsntlqelklpkppslpphlekcilnsntaykedqsvlpnpnhvllnhla aantqlgvlalsattryhrkyvttamfknfd
Timeline for d2qr1b1: