Lineage for d2qr1d1 (2qr1 D:207-297)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 882879Fold d.353: AMPKBI-like [160218] (1 superfamily)
    comprises 3 short helices and 3-stranded meander beta-sheet; makes extensive intermolecular interactions
  4. 882880Superfamily d.353.1: AMPKBI-like [160219] (1 family) (S)
  5. 882881Family d.353.1.1: AMPKBI-like [160220] (3 proteins)
    Pfam PF04739; 5'-AMP-activated protein kinase, beta subunit, complex-interacting region
  6. 882887Protein AMP-activated protein kinase beta subunit [160225] (1 species)
  7. 882888Species Schizosaccharomyces pombe [TaxId:4896] [160226] (6 PDB entries)
    Uniprot P78789 205-297
    Spcc1919.03c
  8. 882894Domain d2qr1d1: 2qr1 D:207-297 [151277]
    Other proteins in same PDB: d2qr1a1, d2qr1c1
    automatically matched to 2OOX B:205-297
    complexed with adp

Details for d2qr1d1

PDB Entry: 2qr1 (more details), 2.7 Å

PDB Description: Crystal structure of the adenylate sensor from AMP-activated protein kinase in complex with ADP
PDB Compounds: (D:) SPCC1919.03c protein

SCOP Domain Sequences for d2qr1d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qr1d1 d.353.1.1 (D:207-297) AMP-activated protein kinase beta subunit {Schizosaccharomyces pombe [TaxId: 4896]}
qysteipafltsntlqelklpkppslpphlekcilnsntaykedqsvlpnpnhvllnhla
aantqlgvlalsattryhrkyvttamfknfd

SCOP Domain Coordinates for d2qr1d1:

Click to download the PDB-style file with coordinates for d2qr1d1.
(The format of our PDB-style files is described here.)

Timeline for d2qr1d1: