Lineage for d2qpva1 (2qpv A:1-133)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1040331Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1040549Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 1040759Family d.129.3.8: Atu1531-like [160742] (3 proteins)
    Pfam PF10604; Polyketide cyclase/dehydrase and lipid transport
  6. 1040760Protein Uncharacterized protein Atu1531 [160745] (1 species)
  7. 1040761Species Agrobacterium tumefaciens [TaxId:358] [160746] (1 PDB entry)
    Uniprot Q7CZ16 1-133
  8. 1040762Domain d2qpva1: 2qpv A:1-133 [151215]
    complexed with acy

Details for d2qpva1

PDB Entry: 2qpv (more details), 2.35 Å

PDB Description: Crystal structure of uncharacterized protein Atu1531
PDB Compounds: (A:) Uncharacterized protein Atu1531

SCOPe Domain Sequences for d2qpva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qpva1 d.129.3.8 (A:1-133) Uncharacterized protein Atu1531 {Agrobacterium tumefaciens [TaxId: 358]}
mpvmqsriihlsvekpwaevydfaanpgnmprwaaglaggleadgedwiakggplgevrv
nfaphnefgvidhvvtlpdglkvynalrvtpngsgtevsftllrlegmtdedfeqdasai
tadlemlksllea

SCOPe Domain Coordinates for d2qpva1:

Click to download the PDB-style file with coordinates for d2qpva1.
(The format of our PDB-style files is described here.)

Timeline for d2qpva1: