Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
Family d.129.3.8: Atu1531-like [160742] (3 proteins) Pfam PF10604; Polyketide cyclase/dehydrase and lipid transport |
Protein Uncharacterized protein Atu1531 [160745] (1 species) |
Species Agrobacterium tumefaciens [TaxId:358] [160746] (1 PDB entry) Uniprot Q7CZ16 1-133 |
Domain d2qpva1: 2qpv A:1-133 [151215] complexed with acy |
PDB Entry: 2qpv (more details), 2.35 Å
SCOPe Domain Sequences for d2qpva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qpva1 d.129.3.8 (A:1-133) Uncharacterized protein Atu1531 {Agrobacterium tumefaciens [TaxId: 358]} mpvmqsriihlsvekpwaevydfaanpgnmprwaaglaggleadgedwiakggplgevrv nfaphnefgvidhvvtlpdglkvynalrvtpngsgtevsftllrlegmtdedfeqdasai tadlemlksllea
Timeline for d2qpva1: