Lineage for d1mlj__ (1mlj -)
- Root: SCOP 1.61
Class a: All alpha proteins [46456] (151 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies) Superfamily a.1.1: Globin-like [46458] (4 families) 
Family a.1.1.2: Globins [46463] (18 proteins) Protein Myoglobin [46469] (9 species) Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (137 PDB entries) 
Domain d1mlj__: 1mlj - [15116]
Details for d1mlj__
PDB Entry: 1mlj (more details), 2 Å
PDB Description: structural and functional effects of apolar mutations of val68(e11) in myoglobin
SCOP Domain Sequences for d1mlj__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mlj__ a.1.1.2 (-) Myoglobin {Sperm whale (Physeter catodon)}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtfltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg
SCOP Domain Coordinates for d1mlj__:
Click to download the PDB-style file with coordinates for d1mlj__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mlj__:
- d1mlj__ first appeared (with stable ids) in SCOP 1.55
- d1mlj__ appears in SCOP 1.59
- d1mlj__ appears in SCOP 1.63
- d1mlj__ appears in the current release, SCOPe 2.08, called d1mlja_
View in 3D