Lineage for d2qp0g1 (2qp0 G:2-151)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1495946Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
    core: 5 helices; contains one more helix and a beta-hairpin outside the core
  4. 1495947Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) (S)
  5. 1495948Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)
  6. 1495949Protein Ribosomal protein S7 [47975] (4 species)
  7. 1495952Species Escherichia coli [TaxId:562] [158599] (24 PDB entries)
    Uniprot P02359 2-151
  8. 1495958Domain d2qp0g1: 2qp0 G:2-151 [151150]
    Other proteins in same PDB: d2qp0b1, d2qp0c1, d2qp0c2, d2qp0d1, d2qp0e1, d2qp0e2, d2qp0f1, d2qp0h1, d2qp0i1, d2qp0j1, d2qp0k1, d2qp0l1, d2qp0m1, d2qp0n1, d2qp0p1, d2qp0q1, d2qp0r1, d2qp0s1, d2qp0t1, d2qp0u1
    automatically matched to 2AVY G:2-151
    protein/RNA complex; complexed with mg, nmy, scm

Details for d2qp0g1

PDB Entry: 2qp0 (more details), 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin and neomycin. This file contains the 30S subunit of the second 70S ribosome, with spectinomycin and neomycin bound. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (G:) 30S ribosomal protein S7

SCOPe Domain Sequences for d2qp0g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qp0g1 a.75.1.1 (G:2-151) Ribosomal protein S7 {Escherichia coli [TaxId: 562]}
rrrvigqrkilpdpkfgsellakfvnilmvdgkkstaesivysaletlaqrsgkseleaf
evalenvrptvevksrrvggstyqvpvevrpvrrnalamrwiveaarkrgdksmalrlan
elsdaaenkgtavkkredvhrmaeankafa

SCOPe Domain Coordinates for d2qp0g1:

Click to download the PDB-style file with coordinates for d2qp0g1.
(The format of our PDB-style files is described here.)

Timeline for d2qp0g1: