SCOPe 2.08: Domain d2qozi2: 2qoz I:1-72

Lineage for d2qozi2 (2qoz I:1-72)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily)
   beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123

4. Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family)

5. Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins)
   Pfam PF03946

6. Protein Ribosomal protein L11, N-terminal domain [54749] (4 species)

7. Species Escherichia coli [TaxId:562] [160201] (29 PDB entries)
   Uniprot P0A7J7 1-72

8. Domain d2qozi2: 2qoz I:1-72 [151125]
   Other proteins in same PDB: d2qoz01, d2qoz11, d2qoz31, d2qoz41, d2qozc1, d2qozc2, d2qozd1, d2qoze1, d2qozf1, d2qozg1, d2qozg2, d2qozh1, d2qozh2, d2qozi1, d2qozj1, d2qozk1, d2qozl1, d2qozm1, d2qozn1, d2qozo1, d2qozp1, d2qozq1, d2qozr1, d2qozs1, d2qozt1, d2qozu1, d2qozv1, d2qozw1, d2qozx1, d2qozy1, d2qozz1
   protein/RNA complex; complexed with mg, nmy, zn
   protein/RNA complex; complexed with mg, nmy, zn

Details for d2qozi2

PDB Entry: 2qoz, 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin and neomycin. This file contains the 50S subunit of the first 70S ribosome, with neomycin bound. The entire crystal structure contains two 70S ribosomes.

PDB Compounds: (I:) 50S ribosomal protein L11

SCOPe Domain Sequences for d2qozi2:

Sequence; same for both SEQRES and ATOM records:

>d2qozi2 d.47.1.1 (I:1-72) Ribosomal protein L11, N-terminal domain {Escherichia coli [TaxId: 562]}
akkvqayvklqvaagmanpsppvgpalgqqgvnimefckafnaktdsiekglpipvvitv
yadrsftfvtkt

Timeline for d2qozi2:

• d2qozi2 first appeared in SCOP 1.75
  
• d2qozi2 appears in SCOPe 2.07