Lineage for d2qozi2 (2qoz I:1-72)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2553569Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily)
    beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123
  4. 2553570Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family) (S)
  5. 2553571Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins)
    Pfam PF03946
  6. 2553575Protein Ribosomal protein L11, N-terminal domain [54749] (4 species)
  7. 2553581Species Escherichia coli [TaxId:562] [160201] (29 PDB entries)
    Uniprot P0A7J7 1-72
  8. 2553588Domain d2qozi2: 2qoz I:1-72 [151125]
    Other proteins in same PDB: d2qoz01, d2qoz11, d2qoz31, d2qoz41, d2qozc1, d2qozc2, d2qozd1, d2qoze1, d2qozf1, d2qozg1, d2qozg2, d2qozh1, d2qozh2, d2qozi1, d2qozj1, d2qozk1, d2qozl1, d2qozm1, d2qozn1, d2qozo1, d2qozp1, d2qozq1, d2qozr1, d2qozs1, d2qozt1, d2qozu1, d2qozv1, d2qozw1, d2qozx1, d2qozy1, d2qozz1
    protein/RNA complex; complexed with mg, nmy, zn
    protein/RNA complex; complexed with mg, nmy, zn

Details for d2qozi2

PDB Entry: 2qoz (more details), 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin and neomycin. This file contains the 50S subunit of the first 70S ribosome, with neomycin bound. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (I:) 50S ribosomal protein L11

SCOPe Domain Sequences for d2qozi2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qozi2 d.47.1.1 (I:1-72) Ribosomal protein L11, N-terminal domain {Escherichia coli [TaxId: 562]}
akkvqayvklqvaagmanpsppvgpalgqqgvnimefckafnaktdsiekglpipvvitv
yadrsftfvtkt

SCOPe Domain Coordinates for d2qozi2:

Click to download the PDB-style file with coordinates for d2qozi2.
(The format of our PDB-style files is described here.)

Timeline for d2qozi2: