SCOPe 2.08: Domain d2qoyd1: 2qoy D:1-205

Lineage for d2qoyd1 (2qoy D:1-205)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
   alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta

4. Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families)
   common motif in otherwise different folds

5. Family d.66.1.2: Ribosomal protein S4 (bacteria) [55178] (1 protein)
   has a RRF/tRNA synthetase additional domain-like fold

6. Protein Ribosomal protein S4 [55179] (3 species)
   also contains a Zn-binding N-terminal subdomain

7. Species Escherichia coli [TaxId:562] [160439] (26 PDB entries)
   Uniprot P0A7V8 1-205

8. Domain d2qoyd1: 2qoy D:1-205 [151093]
   Other proteins in same PDB: d2qoyb1, d2qoyc1, d2qoyc2, d2qoye1, d2qoye2, d2qoyf1, d2qoyg1, d2qoyh1, d2qoyi1, d2qoyj1, d2qoyk1, d2qoyl1, d2qoym1, d2qoyn1, d2qoyp1, d2qoyq1, d2qoyr1, d2qoys1, d2qoyt1, d2qoyu1
   protein/RNA complex; complexed with mg, nmy, scm
   protein/RNA complex; complexed with mg, nmy, scm

Details for d2qoyd1

PDB Entry: 2qoy, 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin and neomycin. This file contains the 30S subunit of the first 70S ribosome, with spectinomycin and neomycin bound. The entire crystal structure contains two 70S ribosomes.

PDB Compounds: (D:) 30S ribosomal protein S4

SCOPe Domain Sequences for d2qoyd1:

Sequence; same for both SEQRES and ATOM records:

>d2qoyd1 d.66.1.2 (D:1-205) Ribosomal protein S4 {Escherichia coli [TaxId: 562]}
arylgpklklsrregtdlflksgvraidtkckieqapgqhgarkprlsdygvqlrekqkv
rriygvlerqfrnyykeaarlkgntgenllallegrldnvvyrmgfgatraearqlvshk
aimvngrvvniasyqvspndvvsirekakkqsrvkaalelaeqrekptwlevdagkmegt
fkrkpersdlsadinehlivelysk

Timeline for d2qoyd1:

• d2qoyd1 first appeared in SCOP 1.75
  
• d2qoyd1 appears in SCOPe 2.07