PDB entry 2qoy

View 2qoy on RCSB PDB site
Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin and neomycin. This file contains the 30S subunit of the first 70S ribosome, with spectinomycin and neomycin bound. The entire crystal structure contains two 70S ribosomes.
Class: ribosome
Keywords: RNA-protein complex, RIBOSOME
Deposited on 2007-07-21, released 2007-08-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.264
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 16s rRNA
    Species: Escherichia coli [TaxId:562]
  • Chain 'B':
    Compound: 30S ribosomal protein S2
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qoyb1
  • Chain 'C':
    Compound: 30S ribosomal protein S3
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qoyc1, d2qoyc2
  • Chain 'D':
    Compound: 30S ribosomal protein S4
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qoyd1
  • Chain 'E':
    Compound: 30S ribosomal protein S5
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qoye1, d2qoye2
  • Chain 'F':
    Compound: 30S ribosomal protein S6
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qoyf1
  • Chain 'G':
    Compound: 30S ribosomal protein S7
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qoyg1
  • Chain 'H':
    Compound: 30S ribosomal protein S8
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qoyh1
  • Chain 'I':
    Compound: 30S ribosomal protein S9
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qoyi1
  • Chain 'J':
    Compound: 30S ribosomal protein S10
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qoyj1
  • Chain 'K':
    Compound: 30S ribosomal protein S11
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qoyk1
  • Chain 'L':
    Compound: 30S ribosomal protein S12
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qoyl1
  • Chain 'M':
    Compound: 30S ribosomal protein S13
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qoym1
  • Chain 'N':
    Compound: 30S ribosomal protein S14
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qoyn1
  • Chain 'O':
    Compound: 30S ribosomal protein S15
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: 30S ribosomal protein S16
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qoyp1
  • Chain 'Q':
    Compound: 30S ribosomal protein S17
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qoyq1
  • Chain 'R':
    Compound: 30S ribosomal protein S18
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qoyr1
  • Chain 'S':
    Compound: 30S ribosomal protein S19
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qoys1
  • Chain 'T':
    Compound: 30S ribosomal protein S20
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qoyt1
  • Chain 'U':
    Compound: 30S ribosomal protein S21
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qoyu1
  • Heterogens: NMY, MG, SCM, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qoyB (B:)
    atvsmrdmlkagvhfghqtrywnpkmkpfifgarnkvhiinlektvpmfnealaelnkia
    srkgkilfvgtkraaseavkdaalscdqffvnhrwlggmltnwktvrqsikrlkdletqs
    qdgtfdkltkkealmrtreleklenslggikdmgglpdalfvidadhehiaikeannlgi
    pvfaivdtnsdpdgvdfvipgnddairavtlylgavaatvregrsqdlasqaeesfveae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qoyB (B:)
    mlkagvhfghqtrywnpkmkpfifgarnkvhiinlektvpmfnealaelnkiasrkgkil
    fvgtkraaseavkdaalscdqffvnhrwlggmltnwktvrqsikrlkdletqsqdgtfdk
    ltkkealmrtreleklenslggikdmgglpdalfvidadhehiaikeannlgipvfaivd
    tnsdpdgvdfvipgnddairavtlylgavaatvregrs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2qoyC (C:)
    gqkvhpngirlgivkpwnstwfantkefadnldsdfkvrqyltkelakasvsrivierpa
    ksirvtihtarpgivigkkgedveklrkvvadiagvpaqiniaevrkpeldaklvadsit
    sqlerrvmfrramkravqnamrlgakgikvevsgrlggaeiartewyregrvplhtlrad
    idyntseahttygvigvkvwifkgeilggmaaveqpekpaaqpkkqqrkgrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qoyC (C:)
    gqkvhpngirlgivkpwnstwfantkefadnldsdfkvrqyltkelakasvsrivierpa
    ksirvtihtarpgivigkkgedveklrkvvadiagvpaqiniaevrkpeldaklvadsit
    sqlerrvmfrramkravqnamrlgakgikvevsgrlggaeiartewyregrvplhtlrad
    idyntseahttygvigvkvwifkgei
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qoyD (D:)
    arylgpklklsrregtdlflksgvraidtkckieqapgqhgarkprlsdygvqlrekqkv
    rriygvlerqfrnyykeaarlkgntgenllallegrldnvvyrmgfgatraearqlvshk
    aimvngrvvniasyqvspndvvsirekakkqsrvkaalelaeqrekptwlevdagkmegt
    fkrkpersdlsadinehlivelysk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2qoyE (E:)
    ahiekqagelqekliavnrvsktvkggrifsftaltvvgdgngrvgfgygkarevpaaiq
    kamekarrnminvalnngtlqhpvkgvhtgsrvfmqpasegtgiiaggamravlevagvh
    nvlakaygstnpinvvratidglenmnspemvaakrgksveeilgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qoyE (E:)
    elqekliavnrvsktvkggrifsftaltvvgdgngrvgfgygkarevpaaiqkamekarr
    nminvalnngtlqhpvkgvhtgsrvfmqpasegtgiiaggamravlevagvhnvlakayg
    stnpinvvratidglenmnspemvaakrgk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2qoyF (F:)
    mrhyeivfmvhpdqseqvpgmierytaaitgaegkihrledwgrrqlaypinklhkahyv
    lmnveapqevidelettfrfndavirsmvmrtkhavteaspmvkakderrerrddfanet
    addaeagdseeeeee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qoyF (F:)
    mrhyeivfmvhpdqseqvpgmierytaaitgaegkihrledwgrrqlaypinklhkahyv
    lmnveapqevidelettfrfndavirsmvmrtkhavteas
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2qoyG (G:)
    prrrvigqrkilpdpkfgsellakfvnilmvdgkkstaesivysaletlaqrsgkselea
    fevalenvrptvevksrrvggstyqvpvevrpvrrnalamrwiveaarkrgdksmalrla
    nelsdaaenkgtavkkredvhrmaeankafahyrwlslrsfshqagasskqpalgyln
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qoyG (G:)
    rrrvigqrkilpdpkfgsellakfvnilmvdgkkstaesivysaletlaqrsgkseleaf
    evalenvrptvevksrrvggstyqvpvevrpvrrnalamrwiveaarkrgdksmalrlan
    elsdaaenkgtavkkredvhrmaeankafa
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qoyH (H:)
    smqdpiadmltrirngqaankaavtmpssklkvaianvlkeegfiedfkvegdtkpelel
    tlkyfqgkavvesiqrvsrpglriykrkdelpkvmaglgiavvstskgvmtdraarqagl
    ggeiicyva
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2qoyI (I:)
    aenqyygtgrrkssaarvfikpgngkivinqrsleqyfgretarmvvrqplelvdmvekl
    dlyitvkgggisgqagairhgitralmeydeslrselrkagfvtrdarqverkkvglrka
    rrrpqfskr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qoyI (I:)
    nqyygtgrrkssaarvfikpgngkivinqrsleqyfgretarmvvrqplelvdmvekldl
    yitvkgggisgqagairhgitralmeydeslrselrkagfvtrdarqverkkvglrkarr
    rpqfskr
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2qoyJ (J:)
    mqnqririrlkafdhrlidqataeivetakrtgaqvrgpiplptrkerftvlisphvnkd
    ardqyeirthlrlvdiveptektvdalmrldlaagvdvqislg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qoyJ (J:)
    ririrlkafdhrlidqataeivetakrtgaqvrgpiplptrkerftvlisphvnkdardq
    yeirthlrlvdiveptektvdalmrldlaagvdvqisl
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2qoyK (K:)
    akapirarkrvrkqvsdgvahihasfnntivtitdrqgnalgwataggsgfrgsrkstpf
    aaqvaaercadavkeygiknlevmvkgpgpgrestiralnaagfritnitdvtpiphngc
    rppkkrrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qoyK (K:)
    rkqvsdgvahihasfnntivtitdrqgnalgwataggsgfrgsrkstpfaaqvaaercad
    avkeygiknlevmvkgpgpgrestiralnaagfritnitdvtpiphngcrppkkrrv
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qoyL (L:)
    atvnqlvrkprarkvaksnvpaleacpqkrgvctrvytttpkkpnsalrkvcrvrltngf
    evtsyiggeghnlqehsvilirggrvkdlpgvryhtvrgaldcsgvkdrkqarskygvkr
    pka
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2qoyM (M:)
    ariaginipdhkhavialtsiygvgktrskailaaagiaedvkiselsegqidtlrdeva
    kfvvegdlrreismsikrlmdlgcyrglrhrrglpvrgqrtktnartrkgprkpikk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qoyM (M:)
    ariaginipdhkhavialtsiygvgktrskailaaagiaedvkiselsegqidtlrdeva
    kfvvegdlrreismsikrlmdlgcyrglrhrrglpvrgqrtktnartrkgprkp
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2qoyN (N:)
    akqsmkarevkrvaladkyfakraelkaiisdvnasdedrwnavlklqtlprdsspsrqr
    nrcrqtgrphgflrkfglsrikvreaamrgeipglkkasw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qoyN (N:)
    akqsmkarevkrvaladkyfakraelkaiisdvnarwnavlklqtlprdsspsrqrnrcr
    qtgrphgflrkfglsrikvreaamrgeipglkkasw
    

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qoyP (P:)
    mvtirlarhgakkrpfyqvvvadsrnarngrfiervgffnpiasekeegtrldldriahw
    vgqgatisdrvaalikevnkaa
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >2qoyQ (Q:)
    tdkirtlqgrvvsdkmeksivvaierfvkhpiygkfikrttklhvhdennecgigdvvei
    recrplsktkswtlvrvvekavl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qoyQ (Q:)
    kirtlqgrvvsdkmeksivvaierfvkhpiygkfikrttklhvhdennecgigdvveire
    crplsktkswtlvrvvekav
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2qoyR (R:)
    aryfrrrkfcrftaegvqeidykdiatlknyitesgkivpsritgtrakyqrqlaraikr
    arylsllpytdrhq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qoyR (R:)
    eidykdiatlknyitesgkivpsritgtrakyqrqlaraikrarylsllpytdrh
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >2qoyS (S:)
    prslkkgpfidlhllkkvekavesgdkkplrtwsrrstifpnmigltiavhngrqhvpvf
    vtdemvghklgefaptrtyrghaadkkakkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qoyS (S:)
    rslkkgpfidlhllkkvekavesgdkkplrtwsrrstifpnmigltiavhngrqhvpvfv
    tdemvghklgefaptrtyr
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >2qoyT (T:)
    aniksakkraiqsekarkhnasrrsmmrtfikkvyaaieagdkaaaqkafnemqpivdrq
    aakglihknkaarhkanltaqinkla
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qoyT (T:)
    niksakkraiqsekarkhnasrrsmmrtfikkvyaaieagdkaaaqkafnemqpivdrqa
    akglihknkaarhkanltaqinkla
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >2qoyU (U:)
    pvikvrenepfdvalrrfkrscekagvlaevrrrefyekptterkrakasavkrhakkla
    renarrtrly
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qoyU (U:)
    ikvrenepfdvalrrfkrscekagvlaevrrrefyekptterkrakasavk