SCOP 1.61: Domain d1cp0a_: 1cp0 A:

Lineage for d1cp0a_ (1cp0 A:)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (18 proteins)

6. Protein Myoglobin [46469] (9 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (137 PDB entries)

8. Domain d1cp0a_: 1cp0 A: [15109]

Details for d1cp0a_

PDB Entry: 1cp0, 2 Å

PDB Description: recombinant sperm whale myoglobin l104n mutant (met)

SCOP Domain Sequences for d1cp0a_:

Sequence; same for both SEQRES and ATOM records:

>d1cp0a_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon)}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikynefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg

Timeline for d1cp0a_:

• d1cp0a_ first appeared (with stable ids) in SCOP 1.55
  
• d1cp0a_ appears in SCOP 1.59
  
• d1cp0a_ appears in SCOP 1.63
  
• d1cp0a_ appears in the current release, SCOPe 2.08