SCOP 1.63: Domain d1mlh__: 1mlh -

Lineage for d1mlh__ (1mlh -)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (18 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (137 PDB entries)

8. Domain d1mlh__: 1mlh - [15105]
   complexed with hem, mto, so4; mutant

Details for d1mlh__

PDB Entry: 1mlh, 2 Å

PDB Description: structural and functional effects of apolar mutations of val68(e11) in myoglobin

SCOP Domain Sequences for d1mlh__:

Sequence; same for both SEQRES and ATOM records:

>d1mlh__ a.1.1.2 (-) Myoglobin {Sperm whale (Physeter catodon)}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtaltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg

Timeline for d1mlh__:

• d1mlh__ first appeared (with stable ids) in SCOP 1.55
  
• d1mlh__ appears in SCOP 1.61
  
• d1mlh__ appears in SCOP 1.65
  
• d1mlh__ appears in the current release, SCOPe 2.08, called d1mlha_