Lineage for d1cq2a_ (1cq2 A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1253685Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1253686Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1253759Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1255251Protein Myoglobin [46469] (9 species)
  7. 1255368Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (230 PDB entries)
    Uniprot P02185
  8. 1255539Domain d1cq2a_: 1cq2 A: [15099]
    neutron structure of fully deuterated protein
    complexed with dod, hem

Details for d1cq2a_

PDB Entry: 1cq2 (more details), 2 Å

PDB Description: neutron structure of fully deuterated sperm whale myoglobin at 2.0 angstrom
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d1cq2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cq2a_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg

SCOPe Domain Coordinates for d1cq2a_:

Click to download the PDB-style file with coordinates for d1cq2a_.
(The format of our PDB-style files is described here.)

Timeline for d1cq2a_: