Lineage for d2qo0a1 (2qo0 A:-10-174)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1881081Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1881082Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1881522Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins)
  6. 1881650Protein Ketoacyl-ACP synthase III (FabH) [53912] (3 species)
  7. 1881678Species Mycobacterium tuberculosis [TaxId:1773] [64196] (12 PDB entries)
  8. 1881683Domain d2qo0a1: 2qo0 A:-10-174 [150968]
    automated match to d2qnza1
    complexed with d1t; mutant

Details for d2qo0a1

PDB Entry: 2qo0 (more details), 1.85 Å

PDB Description: crystal structure of the complex between the a246f mutant of mycobacterium beta-ketoacyl-acyl carrier protein synthase iii (fabh) and 11-(decyldithiocarbonyloxy)-undecanoic acid
PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase 3

SCOPe Domain Sequences for d2qo0a1:

Sequence, based on SEQRES records: (download)

>d2qo0a1 c.95.1.2 (A:-10-174) Ketoacyl-ACP synthase III (FabH) {Mycobacterium tuberculosis [TaxId: 1773]}
mteiattsgarsvgllsvgayrpervvtndeicqhidssdewiytrtgiktrrfaaddes
aasmateacrralsnaglsaadidgvivttnthflqtppaapmvaaslgakgilgfdlsa
gcagfgyalgaaadmirgggaatmlvvgteklsptidmydrgncfifadgaaavvvgetp
fqgi

Sequence, based on observed residues (ATOM records): (download)

>d2qo0a1 c.95.1.2 (A:-10-174) Ketoacyl-ACP synthase III (FabH) {Mycobacterium tuberculosis [TaxId: 1773]}
mteiattsgarsvgllsvgayrpervvtndeicqewiytrtgiktrrfaaddesaasmat
eacrralsnaglsaadidgvivttnthflqtppaapmvaaslgakgilgfdlsagcagfg
yalgaaadmirgggaatmlvvgteklsptidmydrgncfifadgaaavvvgetpfqgi

SCOPe Domain Coordinates for d2qo0a1:

Click to download the PDB-style file with coordinates for d2qo0a1.
(The format of our PDB-style files is described here.)

Timeline for d2qo0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qo0a2