PDB entry 2qo0

View 2qo0 on RCSB PDB site
Description: Crystal structure of the complex between the A246F mutant of mycobacterium beta-ketoacyl-acyl carrier protein synthase III (FABH) and 11-(decyldithiocarbonyloxy)-undecanoic acid
Class: transferase
Keywords: FATTY ACID BIOSYNTHESIS, MYOBACTERIUM TUBERCULOSIS, STRUCTURAL BASIS FOR SUBSTRATE SPECIFICITY, ENZYME INHIBITOR COMPLEX, MECHANISM BASED INHIBITOR, Acyltransferase, Cytoplasm, Lipid synthesis, Multifunctional enzyme, Transferase
Deposited on 2007-07-19, released 2008-05-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.201
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase 3
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: fabH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A574 (0-End)
      • engineered (259)
    Domains in SCOPe 2.05: d2qo0a1, d2qo0a2
  • Chain 'B':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase 3
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: fabH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A574 (0-End)
      • engineered (259)
    Domains in SCOPe 2.05: d2qo0b1, d2qo0b2
  • Heterogens: D1T, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qo0A (A:)
    mteiattsgarsvgllsvgayrpervvtndeicqhidssdewiytrtgiktrrfaaddes
    aasmateacrralsnaglsaadidgvivttnthflqtppaapmvaaslgakgilgfdlsa
    gcagfgyalgaaadmirgggaatmlvvgteklsptidmydrgncfifadgaaavvvgetp
    fqgigptvagsdgeqadairqdidwitfaqnpsgprpfvrlegpavfrwaafkmgdvgrr
    amdaagvrpdqidvfvphqfnsrinellvknlqlrpdavvandiehtgntsaasiplama
    ellttgaakpgdlalligygaglsyaaqvvrmpkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qo0A (A:)
    mteiattsgarsvgllsvgayrpervvtndeicqewiytrtgiktrrfaaddesaasmat
    eacrralsnaglsaadidgvivttnthflqtppaapmvaaslgakgilgfdlsagcagfg
    yalgaaadmirgggaatmlvvgteklsptidmydrgncfifadgaaavvvgetpfqgigp
    tvagsdgeqadairqdidwitfaqnpsgprpfvrlegpavfrwaafkmgdvgrramdaag
    vrpdqidvfvphqfnsrinellvknlqlrpdavvandiehtgntsaasiplamaellttg
    aakpgdlalligygaglsyaaqvvrmpk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qo0B (B:)
    mteiattsgarsvgllsvgayrpervvtndeicqhidssdewiytrtgiktrrfaaddes
    aasmateacrralsnaglsaadidgvivttnthflqtppaapmvaaslgakgilgfdlsa
    gcagfgyalgaaadmirgggaatmlvvgteklsptidmydrgncfifadgaaavvvgetp
    fqgigptvagsdgeqadairqdidwitfaqnpsgprpfvrlegpavfrwaafkmgdvgrr
    amdaagvrpdqidvfvphqfnsrinellvknlqlrpdavvandiehtgntsaasiplama
    ellttgaakpgdlalligygaglsyaaqvvrmpkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qo0B (B:)
    mteiattsgarsvgllsvgayrpervvtndeicqhidewiytrtgiktrrfaaddesaas
    mateacrralsnaglsaadidgvivttnthflqtppaapmvaaslgakgilgfdlsagca
    gfgyalgaaadmirgggaatmlvvgteklsptidmydrgncfifadgaaavvvgetpfqg
    igptvagsdgeqadairqdidwitfaqnpsgprpfvrlegpavfrwaafkmgdvgrramd
    aagvrpdqidvfvphqfnsrinellvknlqlrpdavvandiehtgntsaasiplamaell
    ttgaakpgdlalligygaglsyaaqvvrmpk