Class i: Low resolution protein structures [58117] (26 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.3: Small subunit [58132] (1 protein) |
Protein 30S subunit [58133] (1 species) |
Species Thermus thermophilus [TaxId:274] [58134] (13 PDB entries) |
Domain d2qnhf1: 2qnh f:5-154 [150929] Other proteins in same PDB: d2qnhc1, d2qnhe1, d2qnhg1, d2qnhh1, d2qnhi1, d2qnhj1, d2qnhk1, d2qnhl1, d2qnhm1, d2qnhn1, d2qnho1, d2qnhp1, d2qnhq1, d2qnhr1, d2qnhs1, d2qnht1, d2qnhu1, d2qnhv1 automatically matched to d1fkae_ complexed with 2mg, 5mc, 7mg, m2g, ma6, psu |
PDB Entry: 2qnh (more details), 3.83 Å
SCOP Domain Sequences for d2qnhf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qnhf1 i.1.1.3 (f:5-154) 30S subunit {Thermus thermophilus [TaxId: 274]} dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr nmvevplqngtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelg srnpiniayatmealrqlrtkadverlrkg
Timeline for d2qnhf1: