| Class i: Low resolution protein structures [58117] (26 folds) |
| Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
| Family i.1.1.1: Ribosome complexes [58120] (1 protein) |
| Protein 70S ribosome functional complex [58121] (9 species) |
| Species Thermus thermophilus [TaxId:274] [58122] (21 PDB entries) |
| Domain d2qnht1: 2qnh t:2-81 [150943] Other proteins in same PDB: d2qnhc1, d2qnhe1, d2qnhf1, d2qnhg1, d2qnhh1, d2qnhi1, d2qnhj1, d2qnhk1, d2qnhl1, d2qnhn1, d2qnho1, d2qnhr1, d2qnhs1, d2qnhu1, d2qnhv1 automatically matched to d1ibms_ complexed with 2mg, 5mc, 7mg, m2g, ma6, psu |
PDB Entry: 2qnh (more details), 3.83 Å
SCOP Domain Sequences for d2qnht1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qnht1 i.1.1.1 (t:2-81) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr
Timeline for d2qnht1: