SCOP 1.59: Domain d2mgm__: 2mgm -

Lineage for d2mgm__ (2mgm -)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)

4. Superfamily a.1.1: Globin-like [46458] (3 families)

5. Family a.1.1.2: Globins [46463] (18 proteins)

6. Protein Myoglobin [46469] (9 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (136 PDB entries)

8. Domain d2mgm__: 2mgm - [15092]

Details for d2mgm__

PDB Entry: 2mgm, 1.9 Å

PDB Description: high resolution crystal structures of five distal histidine mutants of sperm whale myoglobin

SCOP Domain Sequences for d2mgm__:

Sequence; same for both SEQRES and ATOM records:

>d2mgm__ a.1.1.2 (-) Myoglobin {Sperm whale (Physeter catodon)}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg

Timeline for d2mgm__:

• d2mgm__ first appeared (with stable ids) in SCOP 1.55
  
• d2mgm__ appears in SCOP 1.57
  
• d2mgm__ appears in SCOP 1.61
  
• d2mgm__ appears in the current release, SCOPe 2.08, called d2mgma_