Class b: All beta proteins [48724] (174 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) |
Family b.43.3.1: Elongation factors [50448] (10 proteins) |
Protein Initiation factor eIF2 gamma subunit, domain II [74962] (3 species) |
Species Sulfolobus solfataricus [TaxId:2287] [141335] (5 PDB entries) Uniprot Q980A5 207-320 |
Domain d2qmua1: 2qmu A:207-320 [150894] Other proteins in same PDB: d2qmua2, d2qmua3, d2qmub1 automatically matched to d2ahoa1 complexed with gdp, po4, zn |
PDB Entry: 2qmu (more details), 3.2 Å
SCOPe Domain Sequences for d2qmua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qmua1 b.43.3.1 (A:207-320) Initiation factor eIF2 gamma subunit, domain II {Sulfolobus solfataricus [TaxId: 2287]} rdlsqkpvmlvirsfdvnkpgtqfnelkggviggsiiqglfkvdqeikvlpglrvekqgk vsyepiftkissirfgdeefkeakpgglvaigtyldpsltkadnllgsiitlad
Timeline for d2qmua1: