Lineage for d2qmua1 (2qmu A:207-320)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2792984Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2792985Family b.43.3.1: Elongation factors [50448] (11 proteins)
  6. 2793120Protein Initiation factor eIF2 gamma subunit, domain II [74962] (3 species)
  7. 2793129Species Sulfolobus solfataricus [TaxId:2287] [141335] (10 PDB entries)
    Uniprot Q980A5 207-320
  8. 2793146Domain d2qmua1: 2qmu A:207-320 [150894]
    Other proteins in same PDB: d2qmua2, d2qmua3, d2qmub1, d2qmub2
    automatically matched to d2ahoa1
    complexed with gdp, po4, zn

Details for d2qmua1

PDB Entry: 2qmu (more details), 3.2 Å

PDB Description: Structure of an archaeal heterotrimeric initiation factor 2 reveals a nucleotide state between the GTP and the GDP states
PDB Compounds: (A:) Translation initiation factor 2 gamma subunit

SCOPe Domain Sequences for d2qmua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qmua1 b.43.3.1 (A:207-320) Initiation factor eIF2 gamma subunit, domain II {Sulfolobus solfataricus [TaxId: 2287]}
rdlsqkpvmlvirsfdvnkpgtqfnelkggviggsiiqglfkvdqeikvlpglrvekqgk
vsyepiftkissirfgdeefkeakpgglvaigtyldpsltkadnllgsiitlad

SCOPe Domain Coordinates for d2qmua1:

Click to download the PDB-style file with coordinates for d2qmua1.
(The format of our PDB-style files is described here.)

Timeline for d2qmua1: