Lineage for d1mboa_ (1mbo A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1253685Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1253686Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1253759Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1255251Protein Myoglobin [46469] (9 species)
  7. 1255368Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (230 PDB entries)
    Uniprot P02185
  8. 1255527Domain d1mboa_: 1mbo A: [15089]
    complexed with hem, oxy, so4

Details for d1mboa_

PDB Entry: 1mbo (more details), 1.6 Å

PDB Description: Structure and refinement of oxymyoglobin at 1.6 angstroms resolution
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d1mboa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mboa_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg

SCOPe Domain Coordinates for d1mboa_:

Click to download the PDB-style file with coordinates for d1mboa_.
(The format of our PDB-style files is described here.)

Timeline for d1mboa_: