Lineage for d2qkca1 (2qkc A:1-83)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1979820Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1980109Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 1980110Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins)
  6. 1980236Protein Mn superoxide dismutase (MnSOD) [46618] (9 species)
  7. 1980300Species Human (Homo sapiens) [TaxId:9606] [46619] (30 PDB entries)
  8. 1980345Domain d2qkca1: 2qkc A:1-83 [150843]
    Other proteins in same PDB: d2qkca2, d2qkcc2
    automated match to d1pl4a1
    complexed with mn

Details for d2qkca1

PDB Entry: 2qkc (more details), 2.3 Å

PDB Description: structural and kinetic study of the differences between human and e.coli manganese superoxide dismutases
PDB Compounds: (A:) Superoxide dismutase [Mn]

SCOPe Domain Sequences for d2qkca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qkca1 a.2.11.1 (A:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
qpalklnggghinhsifwtnlsp

SCOPe Domain Coordinates for d2qkca1:

Click to download the PDB-style file with coordinates for d2qkca1.
(The format of our PDB-style files is described here.)

Timeline for d2qkca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qkca2