Lineage for d2qkaa2 (2qka A:84-196)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1647686Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 1647687Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 1647688Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)
  6. Protein automated matches [226880] (4 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [255569] (1 PDB entry)
  8. 1647959Domain d2qkaa2: 2qka A:84-196 [150840]
    Other proteins in same PDB: d2qkaa1, d2qkac1
    automated match to d1xila2
    complexed with mn

Details for d2qkaa2

PDB Entry: 2qka (more details), 2.2 Å

PDB Description: structural and kinetic study of the differences between human and e.coli manganese superoxide dismutases
PDB Compounds: (A:) Superoxide dismutase [Mn]

SCOPe Domain Sequences for d2qkaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qkaa2 d.44.1.1 (A:84-196) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq
dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymac

SCOPe Domain Coordinates for d2qkaa2:

Click to download the PDB-style file with coordinates for d2qkaa2.
(The format of our PDB-style files is described here.)

Timeline for d2qkaa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qkaa1