Lineage for d2qg9d2 (2qg9 D:101-153)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1244855Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1245239Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (1 family) (S)
  5. 1245240Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)
  6. 1245241Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (2 species)
  7. 1245242Species Escherichia coli [TaxId:562] [57828] (46 PDB entries)
    Uniprot P00478
  8. 1245329Domain d2qg9d2: 2qg9 D:101-153 [150764]
    Other proteins in same PDB: d2qg9a1, d2qg9a2, d2qg9b1, d2qg9c1, d2qg9c2, d2qg9d1
    automatically matched to d1acmb2
    complexed with zn; mutant

Details for d2qg9d2

PDB Entry: 2qg9 (more details), 2.7 Å

PDB Description: structure of a regulatory subunit mutant d19a of atcase from e. coli
PDB Compounds: (D:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d2qg9d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qg9d2 g.41.7.1 (D:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

SCOPe Domain Coordinates for d2qg9d2:

Click to download the PDB-style file with coordinates for d2qg9d2.
(The format of our PDB-style files is described here.)

Timeline for d2qg9d2: