SCOPe 2.03: Domain d1mcya_: 1mcy A:

Lineage for d1mcya_ (1mcy A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (230 PDB entries)
   Uniprot P02185

8. Domain d1mcya_: 1mcy A: [15076]
   complexed with cmo, hem, so4; mutant

Details for d1mcya_

PDB Entry: 1mcy, 1.7 Å

PDB Description: sperm whale myoglobin (mutant with initiator met and with his 64 replaced by gln, leu 29 replaced by phe

PDB Compounds: (A:) myoglobin (carbonmonoxy)

SCOPe Domain Sequences for d1mcya_:

Sequence; same for both SEQRES and ATOM records:

>d1mcya_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
mvlsegewqlvlhvwakveadvaghgqdifirlfkshpetlekfdrfkhlkteaemkase
dlkkqgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgdfgadaqgamnkalelfrkdiaakykelgyqg

Timeline for d1mcya_:

• d1mcya_ first appeared (with stable ids) in SCOP 1.55, called d1mcy__
  
• d1mcya_ appears in SCOPe 2.02
  
• d1mcya_ appears in SCOPe 2.04
  
• d1mcya_ appears in the current release, SCOPe 2.08