Lineage for d2qfpa1 (2qfp A:9-120)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1299191Superfamily b.1.12: Purple acid phosphatase, N-terminal domain [49363] (2 families) (S)
  5. 1299192Family b.1.12.1: Purple acid phosphatase, N-terminal domain [49364] (1 protein)
  6. 1299193Protein Purple acid phosphatase, N-terminal domain [49365] (2 species)
  7. 1299194Species Kidney bean (Phaseolus vulgaris) [TaxId:3885] [49366] (5 PDB entries)
  8. 1299197Domain d2qfpa1: 2qfp A:9-120 [150742]
    Other proteins in same PDB: d2qfpa2, d2qfpb2, d2qfpc2, d2qfpd2
    automatically matched to d1kbpa1
    complexed with f, fe, na, nag, ndg, so4, zn

Details for d2qfpa1

PDB Entry: 2qfp (more details), 2.2 Å

PDB Description: crystal structure of red kidney bean purple acid phosphatase in complex with fluoride
PDB Compounds: (A:) purple acid phosphatase

SCOPe Domain Sequences for d2qfpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qfpa1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}
rdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrkr
iakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitpp

SCOPe Domain Coordinates for d2qfpa1:

Click to download the PDB-style file with coordinates for d2qfpa1.
(The format of our PDB-style files is described here.)

Timeline for d2qfpa1: