Lineage for d2qfpa1 (2qfp A:9-120)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2764739Superfamily b.1.12: Purple acid phosphatase, N-terminal domain [49363] (2 families) (S)
  5. 2764758Family b.1.12.0: automated matches [227279] (1 protein)
    not a true family
  6. 2764759Protein automated matches [227090] (1 species)
    not a true protein
  7. 2764760Species French bean (Phaseolus vulgaris) [TaxId:3885] [226471] (11 PDB entries)
  8. 2764773Domain d2qfpa1: 2qfp A:9-120 [150742]
    Other proteins in same PDB: d2qfpa2, d2qfpb2, d2qfpc2, d2qfpd2
    automated match to d2qfra1
    complexed with f, fe, na, nag, so4, zn

Details for d2qfpa1

PDB Entry: 2qfp (more details), 2.2 Å

PDB Description: crystal structure of red kidney bean purple acid phosphatase in complex with fluoride
PDB Compounds: (A:) purple acid phosphatase

SCOPe Domain Sequences for d2qfpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qfpa1 b.1.12.0 (A:9-120) automated matches {French bean (Phaseolus vulgaris) [TaxId: 3885]}
rdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrkr
iakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitpp

SCOPe Domain Coordinates for d2qfpa1:

Click to download the PDB-style file with coordinates for d2qfpa1.
(The format of our PDB-style files is described here.)

Timeline for d2qfpa1: