Lineage for d2qf3b1 (2qf3 B:43-251)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 952974Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 952975Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 952976Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)
  6. 953109Protein Stress sensor protease DegS, catalytic domain [110236] (1 species)
  7. 953110Species Escherichia coli [TaxId:562] [110237] (9 PDB entries)
    Uniprot P31137 37-354 ! Uniprot P31137
  8. 953112Domain d2qf3b1: 2qf3 B:43-251 [150725]
    automatically matched to d1sota2
    complexed with po4

Details for d2qf3b1

PDB Entry: 2qf3 (more details), 2.04 Å

PDB Description: structure of the delta pdz truncation of the degs protease
PDB Compounds: (B:) Protease degS

SCOPe Domain Sequences for d2qf3b1:

Sequence, based on SEQRES records: (download)

>d2qf3b1 b.47.1.1 (B:43-251) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]}
tpasynlavrraapavvnvynrglntnshnqleirtlgsgvimdqrgyiitnkhvindad
qiivalqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignpy
nlgqtitqgiisatgriglnptgrqnflqtdasinhgnsggalvnslgelmgintlsfdk
sndgetpegigfaipfqlatkimdklird

Sequence, based on observed residues (ATOM records): (download)

>d2qf3b1 b.47.1.1 (B:43-251) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]}
tpasynlavrraapavvnvynrglneirtlgsgvimdqrgyiitnkhvindadqiivalq
dgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignpynlgqtit
qgiisatgriglnptgrqnflqtdasinhgnsggalvnslgelmgintlsftpegigfai
pfqlatkimdklird

SCOPe Domain Coordinates for d2qf3b1:

Click to download the PDB-style file with coordinates for d2qf3b1.
(The format of our PDB-style files is described here.)

Timeline for d2qf3b1: