| Class i: Low resolution protein structures [58117] (25 folds) |
| Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
| Family i.1.1.2: Large subunit [58124] (3 proteins) |
| Protein Prokaryotic (50S subunit) [58125] (3 species) |
| Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries) |
| Domain d2qexn1: 2qex N:1-186 [150702] Other proteins in same PDB: d2qex21, d2qexb1, d2qexc1, d2qexf1, d2qexg1, d2qexh1, d2qexi1, d2qexk1, d2qexm1, d2qexp1, d2qexr1, d2qexs1, d2qexy1, d2qexz1 automatically matched to d1w2bm_ complexed with cd, cl, k, mg, na, neg |
PDB Entry: 2qex (more details), 2.9 Å
SCOPe Domain Sequences for d2qexn1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qexn1 i.1.1.2 (N:1-186) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]}
atgprykvpmrrrreartdyhqrlrllksgkprlvarksnkhvraqlvtlgpngddtlas
ahssdlaeygweaptgnmpsayltgllaglraqeagveeavldiglnsptpgskvfaiqe
gaidagldiphnddvladwqrtrgahiaeydeqleeplysgdfdaadlpehfdelretll
dgdiel
Timeline for d2qexn1:
View in 3DDomains from other chains: (mouse over for more information) d2qex11, d2qex21, d2qex31, d2qexb1, d2qexc1, d2qexd1, d2qexf1, d2qexg1, d2qexh1, d2qexi1, d2qexj1, d2qexk1, d2qexl1, d2qexm1, d2qexo1, d2qexp1, d2qexq1, d2qexr1, d2qexs1, d2qext1, d2qexu1, d2qexv1, d2qexw1, d2qexx1, d2qexy1, d2qexz1 |