Lineage for d2qexq1 (2qex Q:1-95)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3042555Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 3042556Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 3043573Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 3043708Protein Prokaryotic (50S subunit) [58125] (3 species)
  7. 3043855Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 3044046Domain d2qexq1: 2qex Q:1-95 [150705]
    Other proteins in same PDB: d2qex21, d2qexb1, d2qexc1, d2qexf1, d2qexg1, d2qexh1, d2qexi1, d2qexk1, d2qexm1, d2qexp1, d2qexr1, d2qexs1, d2qexy1, d2qexz1
    automatically matched to d1w2bp_
    complexed with cd, cl, k, mg, na, neg

Details for d2qexq1

PDB Entry: 2qex (more details), 2.9 Å

PDB Description: negamycin binds to the wall of the nascent chain exit tunnel of the 50s ribosomal subunit
PDB Compounds: (Q:) 50S ribosomal protein L21e

SCOPe Domain Sequences for d2qexq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qexq1 i.1.1.2 (Q:1-95) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]}
pssngplegtrgklknkprdrgtsppqraveefddgekvhlkidpsvpngrfhprfdgqt
gtvegkqgdaykvdivdggkektiivtaahlrrqe

SCOPe Domain Coordinates for d2qexq1:

Click to download the PDB-style file with coordinates for d2qexq1.
(The format of our PDB-style files is described here.)

Timeline for d2qexq1: