SCOP 1.61: Domain d2mgg__: 2mgg -

Lineage for d2mgg__ (2mgg -)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (18 proteins)

6. Protein Myoglobin [46469] (9 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (137 PDB entries)

8. Domain d2mgg__: 2mgg - [15069]

Details for d2mgg__

PDB Entry: 2mgg, 1.8 Å

PDB Description: high resolution crystal structures of five distal histidine mutants of sperm whale myoglobin

SCOP Domain Sequences for d2mgg__:

Sequence; same for both SEQRES and ATOM records:

>d2mgg__ a.1.1.2 (-) Myoglobin {Sperm whale (Physeter catodon)}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkqgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg

Timeline for d2mgg__:

• d2mgg__ first appeared (with stable ids) in SCOP 1.55
  
• d2mgg__ appears in SCOP 1.59
  
• d2mgg__ appears in SCOP 1.63
  
• d2mgg__ appears in the current release, SCOPe 2.08, called d2mgga_