| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein Immunoglobulin heavy chain alpha constant domain 3, CH3-alpha [89183] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [89184] (3 PDB entries) |
| Domain d2qeja2: 2qej A:343-450 [150681] Other proteins in same PDB: d2qeja1, d2qeja3, d2qejb1 automatically matched to d1ow0a2 complexed with ca, gol |
PDB Entry: 2qej (more details), 3.2 Å
SCOPe Domain Sequences for d2qeja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qeja2 b.1.1.2 (A:343-450) Immunoglobulin heavy chain alpha constant domain 3, CH3-alpha {Human (Homo sapiens) [TaxId: 9606]}
ntfrpevhllpppseelalnelvtltclargfspkdvlvrwlqgsqelprekyltwasrq
epsqgtttfavtsilrvaaedwkkgdtfscmvghealplaftqktidr
Timeline for d2qeja2: