SCOPe 2.08: Domain d2qeja1: 2qej A:242-342

Lineage for d2qeja1 (2qej A:242-342)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain alpha constant domain 2, CH2-alpha [89181] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89182] (3 PDB entries)

8. Domain d2qeja1: 2qej A:242-342 [150680]
   Other proteins in same PDB: d2qeja2, d2qeja3, d2qejb2
   automatically matched to d1ow0a1
   complexed with ca, gol

Details for d2qeja1

PDB Entry: 2qej, 3.2 Å

PDB Description: crystal structure of a staphylococcus aureus protein (ssl7) in complex with fc of human iga1

PDB Compounds: (A:) ig alpha-1 c region

SCOPe Domain Sequences for d2qeja1:

Sequence; same for both SEQRES and ATOM records:

>d2qeja1 b.1.1.2 (A:242-342) Immunoglobulin heavy chain alpha constant domain 2, CH2-alpha {Human (Homo sapiens) [TaxId: 9606]}
chprlslhrpaledlllgseanltctltglrdasgvtftwtpssgksavqgpperdlcgc
ysvssvlpgcaepwnhgktftctaaypesktpltatlsksg

Timeline for d2qeja1:

• d2qeja1 first appeared in SCOP 1.75
  
• d2qeja1 appears in SCOPe 2.07