Lineage for d2qejb1 (2qej B:242-342)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2747630Protein Immunoglobulin heavy chain alpha constant domain 2, CH2-alpha [89181] (1 species)
  7. 2747631Species Human (Homo sapiens) [TaxId:9606] [89182] (3 PDB entries)
  8. 2747636Domain d2qejb1: 2qej B:242-342 [150682]
    Other proteins in same PDB: d2qeja2, d2qeja3, d2qejb2
    automatically matched to d1ow0a1
    complexed with ca, gol

Details for d2qejb1

PDB Entry: 2qej (more details), 3.2 Å

PDB Description: crystal structure of a staphylococcus aureus protein (ssl7) in complex with fc of human iga1
PDB Compounds: (B:) ig alpha-1 c region

SCOPe Domain Sequences for d2qejb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qejb1 b.1.1.2 (B:242-342) Immunoglobulin heavy chain alpha constant domain 2, CH2-alpha {Human (Homo sapiens) [TaxId: 9606]}
chprlslhrpaledlllgseanltctltglrdasgvtftwtpssgksavqgpperdlcgc
ysvssvlpgcaepwnhgktftctaaypesktpltatlsksg

SCOPe Domain Coordinates for d2qejb1:

Click to download the PDB-style file with coordinates for d2qejb1.
(The format of our PDB-style files is described here.)

Timeline for d2qejb1: