SCOP 1.63: Domain d1ofj__: 1ofj -

Lineage for d1ofj__ (1ofj -)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (18 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (137 PDB entries)

8. Domain d1ofj__: 1ofj - [15065]
   complexed with hem, mto, so4; mutant

Details for d1ofj__

PDB Entry: 1ofj, 1.8 Å

PDB Description: recombinant sperm whale myoglobin l29h/h64l/d122n mutant (with initiator met)

SCOP Domain Sequences for d1ofj__:

Sequence; same for both SEQRES and ATOM records:

>d1ofj__ a.1.1.2 (-) Myoglobin {Sperm whale (Physeter catodon)}
mvlsegewqlvlhvwakveadvaghgqdihirlfkshpetlekfdrfkhlkteaemkase
dlkklgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg

Timeline for d1ofj__:

• d1ofj__ first appeared (with stable ids) in SCOP 1.55
  
• d1ofj__ appears in SCOP 1.61
  
• d1ofj__ appears in SCOP 1.65
  
• d1ofj__ appears in the current release, SCOPe 2.08, called d1ofja_